Protein Info for GFF139 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868
Annotation: Mutator mutT protein (7,8-dihydro-8-oxoguanine-triphosphatase) (EC 3.6.1.-)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 80% identical to MUTT_ECOLI: 8-oxo-dGTP diphosphatase (mutT) from Escherichia coli (strain K12)
KEGG orthology group: K03574, 7,8-dihydro-8-oxoguanine triphosphatase [EC: 3.6.1.-] (inferred from 97% identity to sea:SeAg_B0154)MetaCyc: 80% identical to 8-oxo-dGTP diphosphatase (Escherichia coli K-12 substr. MG1655)
RXN-12816 [EC: 3.6.1.58]; 3.6.1.58 [EC: 3.6.1.58]; RXN-11396 [EC: 3.6.1.58, 3.6.1.55]; 3.6.1.55 [EC: 3.6.1.58, 3.6.1.55]
Predicted SEED Role
"Mutator mutT protein (7,8-dihydro-8-oxoguanine-triphosphatase) (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)
MetaCyc Pathways
- 8-oxo-(d)GTP detoxification I (4/4 steps found)
- 8-oxo-(d)GTP detoxification II (4/6 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 3.6.1.-
Use Curated BLAST to search for 3.6.1.- or 3.6.1.55 or 3.6.1.58
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (131 amino acids)
>GFF139 Mutator mutT protein (7,8-dihydro-8-oxoguanine-triphosphatase) (EC 3.6.1.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868) MKKLQIAVGIIRNPNDEIFITQRAADAHMANKLEFPGGKIEAGETPEQALIRELQEEVGI TPTQVTLFDTLEYQFPDRHITLWFWLVERWEGEPWGKEGQPGRWIAQNALSTDDFPPANE PIIRKLRQFAL