Protein Info for GFF1387 in Xanthobacter sp. DMC5

Annotation: 1,2-phenylacetyl-CoA epoxidase, subunit E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 TIGR02160: phenylacetate-CoA oxygenase/reductase, PaaK subunit" amino acids 4 to 357 (354 residues), 434.9 bits, see alignment E=9.1e-135 PF00970: FAD_binding_6" amino acids 14 to 103 (90 residues), 35.8 bits, see alignment E=1.4e-12 PF00175: NAD_binding_1" amino acids 119 to 225 (107 residues), 65.4 bits, see alignment E=1.1e-21 PF00111: Fer2" amino acids 272 to 347 (76 residues), 65.9 bits, see alignment E=3.7e-22

Best Hits

Swiss-Prot: 45% identical to PAAE_ECOLI: 1,2-phenylacetyl-CoA epoxidase, subunit E (paaE) from Escherichia coli (strain K12)

KEGG orthology group: K02613, phenylacetic acid degradation NADH oxidoreductase (inferred from 78% identity to pde:Pden_4806)

MetaCyc: 51% identical to ring 1,2-phenylacetyl-CoA epoxidase PaaE subunit (Pseudomonas sp. Y2)
RXN0-2042 [EC: 1.14.13.149]

Predicted SEED Role

"Phenylacetate-CoA oxygenase/reductase, PaaK subunit"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.149

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (358 amino acids)

>GFF1387 1,2-phenylacetyl-CoA epoxidase, subunit E (Xanthobacter sp. DMC5)
MARFHSLEVVDVRRETRDAVVVTLKPRPEDAAAFDFTQGQYLTFRRDFDGEELRRSYSIC
AGKDEGCLKVGIKKVEGGAFSTWANENLSPGDTLEAMPPMGKFFVPLAPELDRHYLGFAG
GSGITPLLSIIKTVLAREPRSRFTLVYANRQISSIMFREELEDLKNIYLGRLSVLHVLES
EAQEIDLFTGRVDAEKMEGLFKHWIDAKSVDTAFICGPEPMMLAIAAALREHGLSDAQIK
FELFASGQPGRAKAKAVSANVAANGAGTTATVTLDGATRTFHMPREGQSLLDAALSANLD
APYACKAGVCSTCRAKVVEGEVEMAVNHALEDYEVRAGYVLTCQCFPLTEKLVVTYDE