Protein Info for GFF1385 in Xanthobacter sp. DMC5

Annotation: Phenylacetate-coenzyme A ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 TIGR02155: phenylacetate-CoA ligase" amino acids 20 to 440 (421 residues), 732 bits, see alignment E=8.1e-225 PF00501: AMP-binding" amino acids 102 to 298 (197 residues), 54.8 bits, see alignment E=7.3e-19 PF14535: AMP-binding_C_2" amino acids 345 to 440 (96 residues), 90.5 bits, see alignment E=7e-30

Best Hits

Swiss-Prot: 71% identical to PAAK_AZOEV: Phenylacetate-coenzyme A ligase (paaK) from Azoarcus evansii

KEGG orthology group: K01912, phenylacetate-CoA ligase [EC: 6.2.1.30] (inferred from 91% identity to xau:Xaut_0901)

MetaCyc: 71% identical to phenylacetate-CoA ligase (aerobic) (Aromatoleum evansii)
Phenylacetate--CoA ligase. [EC: 6.2.1.30]

Predicted SEED Role

"Phenylacetate-coenzyme A ligase (EC 6.2.1.30)" in subsystem Aromatic amino acid interconversions with aryl acids (EC 6.2.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.30

Use Curated BLAST to search for 6.2.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>GFF1385 Phenylacetate-coenzyme A ligase (Xanthobacter sp. DMC5)
MALPALSPGRSFEGGLDPAERASRDEIMSLQRERLAWSLRHAYENVPFYRQAFDKAGVHP
SDLRDLSDLAKFPFTVKTDLRDNYPFGLFAVPKEKLIRVHGSSGTTGKPIVVGYTKADID
MWADVMARSIRAAGVRPGMMVHVAYGYGLFTGGLGAHYGVERLGCTVVPMSGGMTERQVQ
LIHDFKPDAIMVTPSYMLALMDGFAKAGLDPRETSLKYGIFGAEPWTNAMRQEIERDFAL
DATDIYGLSEVIGPGVAQECVETKDGLHIWEDHFYPEVIDPLTGEVLPDGSKGELVFTSL
TKEAFPIIRYRTRDLTRLLPGTARPGMRRMEKVTGRSDDMIILRGVNVFPTQIEEILLAV
EACSGHYQIELTRDGRMDEMTVHAEIREEVYGEVDVDATGKRILKRIKDTIGITTRITLH
EPGGIERTATGKAKRILDRRPKE