Protein Info for GFF1383 in Sphingobium sp. HT1-2

Annotation: 'Lactyl (2) diphospho-(5')guanosine:7,8-didemethyl-8-hydroxy-5- deazariboflavin 2-phospho-L-lactate transferase (EC 2.7.8.28)' transl_table=11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF01933: CofD" amino acids 3 to 269 (267 residues), 140.6 bits, see alignment E=3.2e-45 TIGR01819: 2-phospho-L-lactate transferase" amino acids 4 to 302 (299 residues), 270.2 bits, see alignment E=9.1e-85

Best Hits

Swiss-Prot: 36% identical to COFD_METAC: 2-phospho-L-lactate transferase (cofD) from Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)

KEGG orthology group: K11212, LPPG:FO 2-phospho-L-lactate transferase [EC: 2.7.8.28] (inferred from 65% identity to swi:Swit_0414)

MetaCyc: 54% identical to 3-phospho-(R)-glycerate transferase (Mycetohabitans rhizoxinica)
RXN-21090 [EC: 2.7.8.28]

Predicted SEED Role

"Lactyl (2) diphospho-(5')guanosine:7,8-didemethyl-8-hydroxy-5-deazariboflavin 2-phospho-L-lactate transferase" in subsystem Coenzyme F420 synthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>GFF1383 'Lactyl (2) diphospho-(5')guanosine:7,8-didemethyl-8-hydroxy-5- deazariboflavin 2-phospho-L-lactate transferase (EC 2.7.8.28)' transl_table=11 (Sphingobium sp. HT1-2)
MSVLALAGGVGGAKLANGLAGVVPAGALTIAVNTGDDFVHMGLHISPDIDSVTYALAGMN
DSVRGWGVADESWAFMDATRRLGGESWFNLGDRDLATHVLRTALLREGTLSSVTADIAAR
LGIGPAIVPMSDDPVRSMIDTDQGEMAFQDYFVRHQCGPRFRSIRFDGAAAARPSAGLLA
ALDDPALEAIILCPSNPILSIDPILAVPGVRDRLVARRVPCVALSPFIAGQAVKGPAAKI
MTELGLPTTPATIARHYDGLIDGLMVDGADAQGWADDGLAVRSADILMRNVDQQRALAAQ
MIDFAAALRRAAP