Protein Info for PS417_00695 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 534 transmembrane" amino acids 31 to 55 (25 residues), see Phobius details amino acids 74 to 87 (14 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 226 to 244 (19 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details amino acids 321 to 340 (20 residues), see Phobius details amino acids 346 to 363 (18 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details PF13231: PMT_2" amino acids 81 to 243 (163 residues), 50.5 bits, see alignment E=1.4e-17

Best Hits

KEGG orthology group: None (inferred from 95% identity to pfs:PFLU0134)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U373 at UniProt or InterPro

Protein Sequence (534 amino acids)

>PS417_00695 membrane protein (Pseudomonas simiae WCS417)
MRRSVVEQNEKVGTLPALNRLSWEGAGWINRLWWVPILALAMALRFYHLTSAAIWGDEGS
SLLLSEYALGDLWFHAAHDVHPPLYFFLLRGWIELFGDSIWSIRAMSAIPGVIVVGLGIW
LTRQLSTRRAALLAGILLALLPTAVRYSQEVRMYSLLGVWLLGATLALVYWVRHPERSRY
LAAYGVLMSAGFYTHYFTALCVLVHWAYLGVLSGAMPRDQRLITRPAWWVANAAIVLMYL
PWLPNLLDLVQHVDQLKVGGDIGWEEPVNLFSLPSMIWQFVLQDEGVGFWAPLFWLFPLL
LVAVVVITAWRDRERHRPASLLALLFLLPLLLVYGVSFISPVFIERYLTVYALSLPILLA
MAIDRLPSRFSLLGAALFVLFVGVELVGLKNNFTVDEHDQFNVPVEFVNRNYQEDDRIVL
SDMMWYLSYVYYDQTDAQLQLYTPPKPDGTPTRPNAYGFGTLVDQDGGRIYLDHLSALPA
DTRRVWLISSNEAPDDFAPLPEGWRELSRQDGGGARARLFVVCNAPSAQPEGCR