Protein Info for GFF1376 in Sphingobium sp. HT1-2

Annotation: Cytochrome c2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00034: Cytochrom_C" amino acids 28 to 121 (94 residues), 35.7 bits, see alignment E=8.8e-13

Best Hits

Swiss-Prot: 44% identical to CYC2_RHOVT: Cytochrome c2 (Rvan_1007) from Rhodomicrobium vannielii (strain ATCC 17100 / ATH 3.1.1 / DSM 162 / LMG 4299)

KEGG orthology group: K08738, cytochrome c (inferred from 74% identity to sch:Sphch_0996)

MetaCyc: 40% identical to cytochrome c (Homo sapiens)

Predicted SEED Role

"Cytochrome c2" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (126 amino acids)

>GFF1376 Cytochrome c2 (Sphingobium sp. HT1-2)
MKHVSRVMMFAMAVAATGPALAQAGDATKGKAVFARCAVCHSVDPGVKKLGPSLSGVFGR
TSGTVPGFTYSPAMQKAKIRWDAKSLDGFLAKPSAAVPGSRMVFAGLPNPADRANLLAYL
AGATKK