Protein Info for GFF1375 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 153 to 170 (18 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details amino acids 218 to 239 (22 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 272 to 291 (20 residues), see Phobius details PF00892: EamA" amino acids 16 to 142 (127 residues), 45.7 bits, see alignment E=4.1e-16 amino acids 153 to 289 (137 residues), 48 bits, see alignment E=8.2e-17

Best Hits

KEGG orthology group: None (inferred from 30% identity to csa:Csal_2674)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>GFF1375 hypothetical protein (Sphingobium sp. HT1-2)
MADGEPMANHRFGPGGMALALLVNIMFALNVIAMKVVVDATAPLLSVALRMGTVFLICAP
ALRPLPGRTGWLMLYGFLNGGLFLLLLNLALFMATNVGALAIAGQLSVPFSLLLGALLLG
ERLNRRKIVGVLLAFAGVVALVFDPHILAEVPAVLVMASAAMVWGGATLVQRKLTGVSVM
NGQAWNGLMGAAVLAPLALIFERPAIAGLAHVGWVPTGWFAFSCLGATVLGQGTLAWLLQ
RYPISTIMPLMLASPVMSTVFASLYFGTPITVGMIAGGTVALLGVTIIAFSPDRRPVD