Protein Info for GFF1374 in Xanthobacter sp. DMC5

Annotation: 50S ribosomal protein L22

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 TIGR01044: ribosomal protein uL22" amino acids 17 to 119 (103 residues), 124.1 bits, see alignment E=1.2e-40 PF00237: Ribosomal_L22" amino acids 17 to 120 (104 residues), 141.1 bits, see alignment E=6.6e-46

Best Hits

Swiss-Prot: 80% identical to RL22_METC4: 50S ribosomal protein L22 (rplV) from Methylobacterium extorquens (strain CM4 / NCIMB 13688)

KEGG orthology group: K02890, large subunit ribosomal protein L22 (inferred from 96% identity to azc:AZC_2549)

MetaCyc: 55% identical to 50S ribosomal subunit protein L22 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L22p (L17e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (126 amino acids)

>GFF1374 50S ribosomal protein L22 (Xanthobacter sp. DMC5)
MGKQAKPRALADNEAKAVARNLRVSPQKLNLVAGLIRGKKVATALADLEFSHKRIARDVK
KCLESAIANAENNHELDVDDLIVAEAHVGKGLVMKRFSPRARGRASRIEKPFAHITIVVR
EVEERA