Protein Info for PS417_06980 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 46 to 67 (22 residues), see Phobius details amino acids 79 to 114 (36 residues), see Phobius details amino acids 159 to 190 (32 residues), see Phobius details amino acids 217 to 240 (24 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details amino acids 305 to 325 (21 residues), see Phobius details amino acids 337 to 357 (21 residues), see Phobius details amino acids 363 to 385 (23 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 204 (180 residues), 76.9 bits, see alignment E=7.5e-26 amino acids 219 to 384 (166 residues), 39.7 bits, see alignment E=1.5e-14

Best Hits

KEGG orthology group: None (inferred from 92% identity to pfs:PFLU1431)

Predicted SEED Role

"Fosmidomycin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UED2 at UniProt or InterPro

Protein Sequence (394 amino acids)

>PS417_06980 membrane protein (Pseudomonas simiae WCS417)
MNHAVAMPVSTRRRTLIAGCSAHAVHDGLTDVIYVLLPIWQAQFALSYAQIGLLRGAYSG
MMAVFQLMASRAAKRWGRVPMLVGGTALAGAAYVLAGQATGLTMLLMALMLGGLGASTQH
PLASSMISDAYEDGGGIKQALSQYNFSGDIGKTLVPGLVGLLLTVIGWRASATFLGWLGL
AAAGLLWWLIPSQSRPSAAPQKTKSPIGTGSTTGLRALILTGTLDSAVRMGFLTFLPFLL
AAKGAGTAGIGLALTLLFIGGAFGKLFCGYLGARIGMMRTVWLTESSTALLIVAAVYLPL
TGLMVMLPLLGLVLNGTSSVLYGAVPDLAGAEKREQAFAVFYTGTIGGGALAPVVFGGVG
DALGVPVAVMVLAGVLLVTLPLAWGVQRGMAESD