Protein Info for PS417_06975 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 44 to 62 (19 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 98 to 121 (24 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 293 to 315 (23 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 341 (330 residues), 124.9 bits, see alignment E=1.9e-40

Best Hits

KEGG orthology group: None (inferred from 92% identity to pfs:PFLU1430)

Predicted SEED Role

"MFS transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0W2 at UniProt or InterPro

Protein Sequence (387 amino acids)

>PS417_06975 membrane protein (Pseudomonas simiae WCS417)
MKPRLHCARLALFLCGCAAFLNLYATQSILQTFATQFHISAKMAGWSITVTTLAVAITAP
FVSRLTGRFELRTVISVAALLLAVPALMTAYADSFAEVLVWRFVEGMLIPVVFATSVAYI
GDRWRGGTVTEVTSLYVAGTVLGGFAGRFVTGVMTEYAGWREAFELLAVLSLTVGGFIQF
LLPASHGRPLRGETAFSAVFRKPLLAAYAVGFCVLFSQVAAFTYAGLYLGLPPFGLGPAA
LGTLYTVFLLALIVIPVAGRLSKSRPHAELLSVAAGLGISGSALTLVPSLWCIVVGLALS
STGVFLAQAAANAFTAATAGDNKAGAVGMYLTCYYLGGSCGAIVPALIWERWGWAGCVTL
IIAFQILTLLIALTGWKPVKPELIPTP