Protein Info for GFF1372 in Variovorax sp. SCN45

Annotation: Uncharacterized MFS-type transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 152 to 176 (25 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 239 to 262 (24 residues), see Phobius details amino acids 268 to 291 (24 residues), see Phobius details amino acids 303 to 320 (18 residues), see Phobius details amino acids 326 to 348 (23 residues), see Phobius details amino acids 360 to 382 (23 residues), see Phobius details amino acids 388 to 407 (20 residues), see Phobius details PF07690: MFS_1" amino acids 34 to 376 (343 residues), 84.7 bits, see alignment E=6.2e-28 PF06779: MFS_4" amino acids 35 to 406 (372 residues), 210.2 bits, see alignment E=6.3e-66

Best Hits

KEGG orthology group: None (inferred from 88% identity to vpe:Varpa_3157)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>GFF1372 Uncharacterized MFS-type transporter (Variovorax sp. SCN45)
MRGTPSLPMSTSLTSTAVPAQPALRLAFALSMGAAVSLGITRFSYGLLLPPMRADLGWSY
ALAGGMNTANAVGYLIGALITPVLMRRFGVTRLLLVGAVLASVFMAGSGFVTAAPALLLQ
RLLAGIASAWVFVAGGLLAARLGEAGSSRGGLLLGIYYGGTGFGIALSALLVPQVLRAAA
DVPHGWAWAWWALAIASAAATCLLAWAGRAMPDRPAAHAASPTATTTSAPPVALHRFGWA
LAGYALFGMGYIGYMTFVIALLREQGASAGFITLFYALLGVACVASSRLWAGLLDRYRGG
QPQALLNGLLGVATLLPVLSPSAPVALVSGVLFGGVFLSVVASTTALVRHNLPPACWAQG
ISMFTIVFAAGQIVGPTVTGWISDGPGGLARGLVASAITLWAAAVLASRQHSLQEA