Protein Info for GFF1369 in Sphingobium sp. HT1-2

Annotation: Acyl-CoA dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 PF02771: Acyl-CoA_dh_N" amino acids 5 to 123 (119 residues), 78.4 bits, see alignment E=1.1e-25 PF02770: Acyl-CoA_dh_M" amino acids 146 to 205 (60 residues), 34.4 bits, see alignment E=4.2e-12 PF00441: Acyl-CoA_dh_1" amino acids 246 to 379 (134 residues), 92.1 bits, see alignment E=7.7e-30 PF08028: Acyl-CoA_dh_2" amino acids 247 to 351 (105 residues), 34.2 bits, see alignment E=6e-12

Best Hits

KEGG orthology group: None (inferred from 77% identity to sch:Sphch_0990)

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.99.2)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases or Butanol Biosynthesis or Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 1.3.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.2

Use Curated BLAST to search for 1.3.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>GFF1369 Acyl-CoA dehydrogenase family protein (Sphingobium sp. HT1-2)
VAVLNEEQTMLKDMASQWVRDRLPVTALRGLYDHGGGGRSGSDGYDAEAWAEMAQMGWCG
IIVPEDHGGADFGYLSLGLVIEELGRTLAASPLISSALVAASALRLAGTQEQQARWLPGI
ADGSLIGTLALDEGPHHAPERTALAATASDDGWKLSGTKRPVQDGMIADLAIVAARTSGA
PGDRDGLTLFLVATDSAGLERLALDQVDARRPALYRFDSVNIAVNDVLGEVGKAADLIDA
IRDRAAIGMAAEMLGSATQAFDITLDYLKTRVQFGAIIGSFQALQHRAAELFGELQLTRS
AVETALAAIDADDPALPALASLAKATAGETLHRISSQMVQLHGGIGMTHEHDAGLYLKRA
RVAEQCHGSTAWHRERWARLNGY