Protein Info for GFF1368 in Xanthobacter sp. DMC5

Annotation: 50S ribosomal protein L24

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 TIGR01079: ribosomal protein uL24" amino acids 3 to 103 (101 residues), 129.3 bits, see alignment E=3.4e-42 PF00467: KOW" amino acids 7 to 37 (31 residues), 32.3 bits, see alignment E=6.2e-12 PF17136: ribosomal_L24" amino acids 40 to 103 (64 residues), 104.3 bits, see alignment E=3.4e-34

Best Hits

Swiss-Prot: 90% identical to RL24_AZOC5: 50S ribosomal protein L24 (rplX) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K02895, large subunit ribosomal protein L24 (inferred from 91% identity to xau:Xaut_4787)

MetaCyc: 50% identical to 50S ribosomal subunit protein L24 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L24p (L26e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (105 amino acids)

>GFF1368 50S ribosomal protein L24 (Xanthobacter sp. DMC5)
MAAKIKKGDKVVVLAGRDKGRTGEVIQVMPKDEKALVRGVNIVKRHQRQSANQEGGIISK
EAPIHLSNVAIADPKDGKPTRVGFEVLDDGRKVRVAKRSGERIDG