Protein Info for GFF1366 in Sphingobium sp. HT1-2

Annotation: Cytochrome P450

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 244 to 266 (23 residues), see Phobius details PF00067: p450" amino acids 200 to 378 (179 residues), 69.1 bits, see alignment E=1.7e-23

Best Hits

Swiss-Prot: 69% identical to Y4VG_SINFN: Probable cytochrome P450 127A1 (cyp127A1) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 89% identity to sch:Sphch_0988)

Predicted SEED Role

"CYTOCHROME P450"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>GFF1366 Cytochrome P450 (Sphingobium sp. HT1-2)
METMAARPIPAHVPPDMIGNFSLFSSPGLEPTPNGDPQAASAVVHDGPRIFYSPVNTRDG
KGTWVITRAQDQRRVLQDPETFSSHRSIFASALGESWPMIPLELDPPDHGKFRSLLNPLL
SPKRVMALETAVRERASVLIDRIAASGTSCDVMTDFAFPFAVNIFLRFLGLSDDRLDEFV
GWANDLLHGDNVKRPAAARTIVAFIDELSADRRRQPVDDFMSFLVQSRIDDRPLTDMEIR
GTGVLLFIAGLDTVAAAIGFDLNYLARHQADQQWLRDDPKRIVLAAEELLRAYPTVQMIR
VATKDVDFEGAPIRKGDYVSCATMIANRDPLEFSDPARIDLAREDNRHTAFAYGPHRCLG
SHLARREIVVGLEEWLKRIPTFRIKSGTAPVTYGGHVFGIENLILDWSQEDAA