Protein Info for PS417_06940 in Pseudomonas simiae WCS417

Annotation: MFS transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 26 to 46 (21 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 122 to 145 (24 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 189 to 211 (23 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details amino acids 321 to 339 (19 residues), see Phobius details amino acids 345 to 365 (21 residues), see Phobius details amino acids 372 to 394 (23 residues), see Phobius details amino acids 414 to 433 (20 residues), see Phobius details PF07690: MFS_1" amino acids 34 to 398 (365 residues), 136.5 bits, see alignment E=5.4e-44

Best Hits

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU1418)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TX06 at UniProt or InterPro

Protein Sequence (443 amino acids)

>PS417_06940 MFS transporter permease (Pseudomonas simiae WCS417)
MSTNTLEAGARPAAEIDAEKALVSKVAWRLMPLIMVCYLFAFFDRINISFAKFQLQADLS
LSDTAYGLGAGLFVVGYVIFEVPSNMMLYKVGARRWIARIMMSWGLATAAMVFVTAEWQF
YALRFLIGAMEAGFAPGVLYYLTLWFPQHFRGRITSMLFLASAFAGLVGAPFSGLVLEHL
DGVLQMRGWHWLFLLGGLPCIGLGFLVLTLLKDRIEDAHWLTAAEKTLLSSRIAKHEPNQ
HGGSLLSAIRIPGFLMLGFIYFLIQVASYGLNFWAPQLIRSAGTQSPVMIGLLTAIPYVC
GAISMVVIGRLSDATGERRKFVCGLVVLGAVGFFSAGIFADHTTFLIIALGMLGAGIIAS
IPTFWTLPPKLLAGAGAGAAGGIAVINTLGQFGGIVSPVMVGRIKDLTGSTTPALYVIGV
CALLAAALLLWGLPQKLRTLDKG