Protein Info for GFF1365 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Putative glutathione transporter, ATP-binding component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 PF00005: ABC_tran" amino acids 65 to 218 (154 residues), 123.5 bits, see alignment E=1.1e-39 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 268 to 351 (84 residues), 91.4 bits, see alignment E=1.5e-30 PF08352: oligo_HPY" amino acids 269 to 333 (65 residues), 75.2 bits, see alignment E=4.2e-25

Best Hits

Swiss-Prot: 52% identical to YKFD_BACSU: Putative oligopeptide transport ATP-binding protein YkfD (ykfD) from Bacillus subtilis (strain 168)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 82% identity to aaa:Acav_0891)

Predicted SEED Role

"Putative glutathione transporter, ATP-binding component" in subsystem Utilization of glutathione as a sulphur source

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (358 amino acids)

>GFF1365 Putative glutathione transporter, ATP-binding component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSADMIEKAVLAAQARNATSAPVPAATPEAPLVRATDLAKTFDVSAPWLNRVIERQPRQL
LRAVDGVSFDIPRGQTLALVGESGCGKSTVARLLVGLYGPTRGGFEFDGQDAHAAFKTPE
GRKLRRRIQMIFQDPYASLNPRWRVEDIIAEPLREHEIETDPEALRARVDDLLKSVGLSP
LDRVKYPHQFSGGQRQRISIARALATQPEFLVCDEPTSALDVSVQAQVLNIMKDLQRERG
LTYLFISHNLAVVRHVSDQVGVMYLGRLVELAPKHTLFERPRHPYTRMLLDAIPKMHDTG
KARTPVSGEVPNPLNPPSGCAFNPRCPHANDRCRSERPNLLDLGGIRIACHAVEEGRI