Protein Info for PS417_06910 in Pseudomonas simiae WCS417

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 42 to 60 (19 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 154 to 154 (1 residues), see Phobius details amino acids 161 to 185 (25 residues), see Phobius details amino acids 206 to 230 (25 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details amino acids 299 to 321 (23 residues), see Phobius details amino acids 333 to 356 (24 residues), see Phobius details amino acids 362 to 382 (21 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 348 (338 residues), 115.2 bits, see alignment E=3.2e-37 PF00083: Sugar_tr" amino acids 43 to 121 (79 residues), 28.2 bits, see alignment E=9.5e-11

Best Hits

KEGG orthology group: None (inferred from 91% identity to pfs:PFLU1413)

Predicted SEED Role

"Bicyclomycin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UHI8 at UniProt or InterPro

Protein Sequence (395 amino acids)

>PS417_06910 MFS transporter (Pseudomonas simiae WCS417)
MKNSTTLTLACSAAFLAQVGISSYLPAVPAIARSLPAAEGHVALALAIYLVGMALPMLLW
GHLSERFGRKPVLLAALAVYALASAAIPSAFNVEAFLALRLVQGLGAGGVSVMARVLVRD
SFSGALLAKGLSWLGMTFVIALGIGQFAGSLLQVILGWEAIFYGLAIGALGLMLVLQRVM
FPALVKADESLSAWRIYATIVRHPPFLYPALAGGLGYGVIIAFNTCAPLILQGRFEWSAA
QYGGLGWPISAAYLAGALMVNRFVARSGRLTMMGWGVALLLTGTAVMLLGSVFAGGLAIL
LWLPYCVAVLGQSMSYPISLSVANDESPVSGSYAMALSGFMHQLMAALIGGMASLLVSQQ
AWSLAALCMALAGAAWVCVARCRADQNALRKISSI