Protein Info for GFF1357 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Sensory box histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 674 TIGR00229: PAS domain S-box protein" amino acids 141 to 260 (120 residues), 37.2 bits, see alignment E=1.4e-13 amino acids 283 to 407 (125 residues), 59 bits, see alignment E=2.7e-20 PF08448: PAS_4" amino acids 150 to 257 (108 residues), 52.9 bits, see alignment E=1.4e-17 amino acids 292 to 404 (113 residues), 26.8 bits, see alignment E=1.8e-09 PF13426: PAS_9" amino acids 161 to 254 (94 residues), 24 bits, see alignment E=1.3e-08 amino acids 298 to 402 (105 residues), 43.7 bits, see alignment E=1e-14 PF00989: PAS" amino acids 286 to 400 (115 residues), 44.3 bits, see alignment E=5.6e-15 PF00512: HisKA" amino acids 438 to 500 (63 residues), 39.2 bits, see alignment E=2e-13 PF02518: HATPase_c" amino acids 544 to 656 (113 residues), 84.3 bits, see alignment E=2.9e-27

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (674 amino acids)

>GFF1357 Sensory box histidine kinase (Hydrogenophaga sp. GW460-11-11-14-LB1)
METPEQQLERLLALRTQELQAALDSARSLCDQASCGLLTFDTEQRCVHLNQALLGWLGHG
APGMPLNELVAPRSRDALTTHVESLRQSGQSEPVDLDWQRVDGSLFRARLASTPVFDAEG
HFLHGSAVVTPLDAAQAASAQDSLLRSITDRIPARLAYYDKNLICRFANHAHAARYGKLP
IDMVGSPLSQVVRPDILPDILPRVAQALSGQTQTFEAERVAADGSRNYFEIHYIPDFQNG
SVEGFFIELHDITERRRTEEFVLHANQDLEERVRSRSAELFASEQRYRLMVDAIQDYCIY
FVDENGGITEWTESAQRLHGHTRSQIMGRSYEVLLSTDNAGEDEVDPGQVLRLAKAHGQW
ETRGWRLREDGSRFWAHTVLTALRNEAGELQGLSSITRDMTAAKSLEDVMNDLNRELEKR
VAERTQQLVAANKDLDVFSHMVSHDLRAPLRHIASFVSLLQEQMGDSADTLALQYQNSIA
KASKRMSLMIEGLLEYARLGRVAVDTQPVPIAQLVQGVIAHLKQENPDRRIEWVIENDLP
IVRGDAMLLAQALGNLLGNAVKYTRPRDAARIEVGWKVNPVGGRTFYIADNGVGFDLEKA
HNLFVMFQRQHHSMDFEGTGTGLALSQRIIERHGGRIWSETAPGEGCTFYFTLPFDGMEQ
DMAFPESSLAELPA