Protein Info for GFF1356 in Variovorax sp. SCN45

Annotation: Putative manganese efflux pump MntP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 40 to 62 (23 residues), see Phobius details amino acids 69 to 86 (18 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 133 to 158 (26 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details PF02659: Mntp" amino acids 31 to 181 (151 residues), 179.4 bits, see alignment E=2.1e-57

Best Hits

Swiss-Prot: 67% identical to MNTP_PARPJ: Putative manganese efflux pump MntP (mntP) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: None (inferred from 67% identity to bpy:Bphyt_6717)

MetaCyc: 60% identical to Mn2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-487

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (189 amino acids)

>GFF1356 Putative manganese efflux pump MntP (Variovorax sp. SCN45)
MNIASTIILAFAMSTDAFAAAVGKGAALRKPSWREALRTGVIFGVIEAITPVIGWAAGLA
AASYVERWDHWIAVTLLSVLGLRMIWEGCGTPDAVEDKPNRNSFWTLAITGFATSIDAMA
VGVGLAFINVNIAWTALAIGLATLTMVTLGVMVGRVLGAVVGKRAEIVGGVLLIGIGFFI
LYEHLNGLA