Protein Info for GFF1355 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details PF04093: MreD" amino acids 28 to 160 (133 residues), 31.8 bits, see alignment E=7.5e-12

Best Hits

KEGG orthology group: K03571, rod shape-determining protein MreD (inferred from 84% identity to sjp:SJA_C1-17950)

Predicted SEED Role

"Rod shape-determining protein MreD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (175 amino acids)

>GFF1355 hypothetical protein (Sphingobium sp. HT1-2)
MIDRNLPPVPRLGRHPSRWRLAGTPVVTVMLGSMLTILPVIAQSPAMPPFGLLVLLAWRL
LRPELWRAWVGLPLGLFDDMMSGQPIGSAMFLWTVMLIGIDAIEHRLVWRSYRQDWLIAT
MAIIFCLAGGVFFARITGGGPVKLLLVAPQMLWTILLFPFVVRQCARIDRWRVMA