Protein Info for PS417_06880 in Pseudomonas simiae WCS417

Annotation: RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 13 to 169 (157 residues), 93.3 bits, see alignment E=6.4e-31 PF04542: Sigma70_r2" amino acids 16 to 78 (63 residues), 40.5 bits, see alignment E=3.7e-14 PF07638: Sigma70_ECF" amino acids 62 to 170 (109 residues), 36.3 bits, see alignment E=1.1e-12 PF08281: Sigma70_r4_2" amino acids 113 to 165 (53 residues), 63.6 bits, see alignment E=2.1e-21 PF04545: Sigma70_r4" amino acids 118 to 166 (49 residues), 41.9 bits, see alignment E=1.1e-14

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 94% identity to pfs:PFLU1407)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UEB4 at UniProt or InterPro

Protein Sequence (179 amino acids)

>PS417_06880 RNA polymerase sigma factor (Pseudomonas simiae WCS417)
MSRPKPDLLSADAFRGFYTDILYFLRKRTDNASDAADMTQDVFTQWLDYRDRAKVEQPRA
FLFQMARNLLRDHWRKQKVRHTVHSDQADMDAEPATDEQNDPMAAVQRLQRLEQLKEVLA
ELSPRRREALMLHRFEGLSQAQIAERMGISTSMVEKHIAFALLHCKRRLQHEPGTEQPE