Protein Info for GFF1353 in Sphingobium sp. HT1-2

Annotation: Rod shape-determining protein MreB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 TIGR00904: cell shape determining protein, MreB/Mrl family" amino acids 12 to 338 (327 residues), 492.1 bits, see alignment E=3.8e-152 PF06723: MreB_Mbl" amino acids 13 to 338 (326 residues), 468.7 bits, see alignment E=2.1e-144 PF00012: HSP70" amino acids 110 to 206 (97 residues), 43.1 bits, see alignment E=4.5e-15 PF14450: FtsA" amino acids 163 to 324 (162 residues), 48.9 bits, see alignment E=2.1e-16

Best Hits

Swiss-Prot: 65% identical to MREB_CAUVN: Cell shape-determining protein MreB (mreB) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K03569, rod shape-determining protein MreB and related proteins (inferred from 99% identity to sch:Sphch_0845)

Predicted SEED Role

"Rod shape-determining protein MreB" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>GFF1353 Rod shape-determining protein MreB (Sphingobium sp. HT1-2)
MSIFSRLFKFSSQDMAIDLGTANTVVYVRGRGIVLNEPSVVAVETLNGVKRVKAVGDDAK
LMMGKTPDSIEAIRPLRDGVIADIDVAEQMIKHFINKVHGGKHSPWRAPEIVICVPSGST
SVERRAIRDAASNAGASQVFLIEEPMAAAIGADMPVTEPIGSMVVDIGGGTTEVAVLSLR
GLAYTTSVRVGGDKMDEAIVSFVRRHHNLLIGEATAERIKKQFGVAQPPEDGVGETIHIK
GRDLVNGVPKEISINQGQIADALAEPISTIVEGVRIALENTAPELAADIVDQGIVLTGGG
ALLKGLDDELRDETGLPVTIAEDPLTCVAIGTGRAMEDPIFRGVLQTA