Protein Info for GFF1352 in Xanthobacter sp. DMC5

Annotation: Periplasmic pH-dependent serine endoprotease DegQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02037: peptidase Do" amino acids 42 to 482 (441 residues), 483.5 bits, see alignment E=3.2e-149 PF00089: Trypsin" amino acids 107 to 266 (160 residues), 73 bits, see alignment E=9.9e-24 PF13365: Trypsin_2" amino acids 108 to 245 (138 residues), 122.6 bits, see alignment E=6.7e-39 PF00595: PDZ" amino acids 286 to 363 (78 residues), 29.1 bits, see alignment E=3.1e-10 amino acids 413 to 460 (48 residues), 30.2 bits, see alignment 1.4e-10 PF13180: PDZ_2" amino acids 287 to 374 (88 residues), 43.8 bits, see alignment E=7.8e-15 amino acids 416 to 480 (65 residues), 47 bits, see alignment E=7.7e-16 PF17820: PDZ_6" amino acids 312 to 348 (37 residues), 34 bits, see alignment 6e-12 amino acids 422 to 461 (40 residues), 41.5 bits, see alignment 2.6e-14

Best Hits

KEGG orthology group: None (inferred from 82% identity to xau:Xaut_4771)

Predicted SEED Role

"Serine protease precursor MucD/AlgY associated with sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (485 amino acids)

>GFF1352 Periplasmic pH-dependent serine endoprotease DegQ (Xanthobacter sp. DMC5)
MFGRLSGLAAAAAFALLLGTPAFAQPAAQQRVPASQAEVTLTFAPVVAKTAPAVVNVYAL
KTAQQRVNPIFDDPFFRRFFGMPGPGGPGGPGDGPGLRAPERVQRSLGSGVIVDPSGLVL
TNYHVIEGADEIRIALNDRREYEAEVLLRDQRTDLAVLRIKTEAKERFPFLELGDSDSLA
VGDLVLAIGDPFGVGQTVTQGIVSALARTQVGVSDYQFFIQTDAAINPGNSGGPLVDMAG
RVVGINSAIYSRSGGSHGIGFAIPANMGRVVVEQAKSGSKSVRRPWLGAKLQRVTPDIAE
SLGLPRPTGVLVQSVTAGSPAAKAGLRTGDLVVSVEGQGIDDPESLNYRLATRPIGGRAA
LLVNRSGKDQTLVVVLEVAPETVPREELLLRGRSPFAGATIVNLSPAVAEELKVDTNATG
VVVYDVQDNSPAAAAGFRPGDVIVEVNNEKVARTGDLNQLAAVPQRGWRVTVLRGGRSIT
AVLRG