Protein Info for GFF1352 in Variovorax sp. SCN45

Annotation: Probable glutathione s-transferase protein (EC 2.5.1.18)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF13417: GST_N_3" amino acids 6 to 80 (75 residues), 60.8 bits, see alignment E=3.2e-20 PF13409: GST_N_2" amino acids 11 to 75 (65 residues), 46.9 bits, see alignment E=8.6e-16 PF13410: GST_C_2" amino acids 151 to 213 (63 residues), 36.8 bits, see alignment E=8.5e-13 PF00043: GST_C" amino acids 156 to 216 (61 residues), 25.7 bits, see alignment E=2.9e-09

Best Hits

KEGG orthology group: None (inferred from 94% identity to vpe:Varpa_3175)

Predicted SEED Role

"Probable glutathione s-transferase protein (EC 2.5.1.18)" (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>GFF1352 Probable glutathione s-transferase protein (EC 2.5.1.18) (Variovorax sp. SCN45)
MADLILHHYTTSPFSEKVRLILGAKKLPWKSVFIPPIMPKPDVETLTGGYRKTPFLQIGA
DMYCDSALIADVLEHLQPEPTLYPEPEKGLSRILAQWADTTLFWAAMAWNLQPRGAAEVF
AKAPPEAAKAFGEDRGKMSAGNMTRLRPADATSAYKSYLRRLSDMLDDKPFLLGEVPSIA
DFSAYHPLWYTRRIESVRTILDLTPAVVDWMDRMAAIGHGAPEKFTSDEAIAAAKAATPH
TLLTDSTFQDDHGIPLGSAVTIRAESFGLEETPGTLVAATRTHYTLERTGERVGTVHVHF
PRIGYVLKKVDA