Protein Info for PS417_06870 in Pseudomonas simiae WCS417

Annotation: TonB-dependent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 852 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF07660: STN" amino acids 55 to 104 (50 residues), 28.8 bits, see alignment 1.3e-10 TIGR01785: TonB-dependent heme/hemoglobin receptor family protein" amino acids 118 to 849 (732 residues), 436.3 bits, see alignment E=2.2e-134 TIGR01786: TonB-dependent hemoglobin/transferrin/lactoferrin receptor family protein" amino acids 127 to 848 (722 residues), 357.9 bits, see alignment E=1.2e-110 PF07715: Plug" amino acids 131 to 235 (105 residues), 72.1 bits, see alignment E=8.1e-24 PF00593: TonB_dep_Rec" amino acids 345 to 823 (479 residues), 132.1 bits, see alignment E=7.9e-42

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 73% identity to pfs:PFLU1405)

Predicted SEED Role

"Putative Ton-B dependent hemine receptor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U8F3 at UniProt or InterPro

Protein Sequence (852 amino acids)

>PS417_06870 TonB-dependent receptor (Pseudomonas simiae WCS417)
MFRAPCHASHLFFRPTLIASCLVFSLNAQAESLTLQLPAQPLATSLSQVAQQAKIQLLFD
EELLKNVQAPALNGNFTPEVAIRTLLKNGELTLIKVGSTYVVRPDEGTTTQSGVIQLDAL
SVIGTGTEVNSSTVGRSTLSQEDIDRYQSNNIPSLLQTLPGVSQGGSLKPGGQTINIRGF
GDAEDVPLTVDGATKSGFERYQQGTVFIEPELIKSIEVEKGPNSPFTGNGGFGGTVNMTT
KDAPDLLKDGRNSGAMLKYGYSSNDHEQVYSSAVFGRTDDGRFDALAYLTQRDGDDMKVA
AKLPNENNQYPINPQRLPNSAQNVDGKLFKVNAHFTEEHAVGLSYSRSHSNRWTPFSAAS
YPTPPTQANIDRYGYEAALKRFLAHRDTVDTTWSGKYEYTPVDNPLVDLTVKYSQSNTDQ
TDERDATAFFQLATGGRKMDTAYTDKNLDVRNVSLFDTGPLQHAVTVGGQIRKHIRETEM
WMPGTTYNTPRYNYGHFQPGFMPHGKVDTNSFFVQDAVTLGDVTITPSMRYDHVRNRGEA
NDAPYYSNPDPSIGHDYSDRTYTGWSPRLAVFWTVNPNLGLFANWSKTWRAPVIDEQYEV
QGLGSRTATSVDLDPERITSISVGSVSSFDNLIAHDDNLQLRTTFFHNKVEDEIFKATGV
GCQNQAINGGSISTACPPGALSNYRNIGGLTIKGFELESFYNSTYLFGSVSFAYAKGDHE
GAYTNPWGPDVAARDIPPTKWVLVLGTHIPAWDAQVGWTGQFIGATSRLPSDNYSGGPGS
GVGDLFYDQYGNKRYNTQGLFAKWKPQQAYLKGTEVNFTVDNVFNNNFRPALSGDRAYTK
GRDAKISVTRFF