Protein Info for GFF1348 in Xanthobacter sp. DMC5

Annotation: Putative fluoride ion transporter CrcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 35 to 59 (25 residues), see Phobius details amino acids 71 to 94 (24 residues), see Phobius details amino acids 101 to 125 (25 residues), see Phobius details TIGR00494: protein CrcB" amino acids 7 to 124 (118 residues), 90.9 bits, see alignment E=3.7e-30 PF02537: CRCB" amino acids 7 to 122 (116 residues), 90.2 bits, see alignment E=4.9e-30

Best Hits

Swiss-Prot: 63% identical to CRCB2_NITHX: Putative fluoride ion transporter CrcB 2 (crcB2) from Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)

KEGG orthology group: K06199, CrcB protein (inferred from 74% identity to xau:Xaut_4768)

Predicted SEED Role

"Protein crcB homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (129 amino acids)

>GFF1348 Putative fluoride ion transporter CrcB (Xanthobacter sp. DMC5)
MTLPPALIVFLGAGLGGTIRHFVNMAVPRLLGTGFPFATFLINVSGSLIMGLMAGYLAFK
DGETWTQPVRLFLTTGVLGGYTTFSTFSLDFLYLAERGELGMALAYAFGSVLLGFGGVWA
GIMLVRSLT