Protein Info for GFF1346 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 12 to 68 (57 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 205 to 229 (25 residues), see Phobius details amino acids 242 to 267 (26 residues), see Phobius details amino acids 274 to 291 (18 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 33 to 277 (245 residues), 109.6 bits, see alignment E=7.9e-36

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 77% identity to rme:Rmet_3516)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>GFF1346 Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNTTSKNILYGLLLLVLLAVPFIGIYPVLVMKLLCFALFASAFNLLLGYTGLLSFGHAAF
LGGSAYVAGHALKVWGVPPELGLVLGTLTGAVLGWLVGSLAIRRQGIYFTMITLALAQML
FFFCLQMPFTGGEDGLQAVPRGRLLGFIELGNDMTMYYFTLLITVAAFLLIMRIVHSPFG
QILKAIKENEPRAISLGYDTQRFKLLVFVLSAALSGLAGSLKTLAMGFATLTDVHWTMSG
SVVLMTLVGGLGTLSGPLVGAAVVIALENKLGEIGHFLAGVTGIDWFNGLGESVTMVIGF
IFVVCVLAFRRGIMGEAIALVERWRGKQA