Protein Info for GFF1344 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 50 to 85 (36 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 144 to 174 (31 residues), see Phobius details amino acids 187 to 210 (24 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 326 to 345 (20 residues), see Phobius details amino acids 357 to 379 (23 residues), see Phobius details amino acids 391 to 413 (23 residues), see Phobius details amino acids 419 to 437 (19 residues), see Phobius details amino acids 449 to 473 (25 residues), see Phobius details amino acids 493 to 520 (28 residues), see Phobius details amino acids 532 to 557 (26 residues), see Phobius details amino acids 585 to 606 (22 residues), see Phobius details PF06808: DctM" amino acids 52 to 374 (323 residues), 160.4 bits, see alignment E=3.2e-51 amino acids 386 to 609 (224 residues), 158.3 bits, see alignment E=1.4e-50

Best Hits

KEGG orthology group: None (inferred from 89% identity to xau:Xaut_4764)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctM subunit, unknown substrate 6"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (650 amino acids)

>GFF1344 hypothetical protein (Xanthobacter sp. DMC5)
MSFVRTLLKRRPLAALAVALLAVLLIALPDVAMAAEPGFRGWFIHNMAPIMFGALVLFLL
LGYPVAFSLAANGLIFGLIGIYLGLFEPKFLQALPERVYGTMNNEVLLAVPFFTFMGLIL
ERSGMAEDLLDTIGQVFGSIRGGLAYAVIFVGALLAATTGVVAASVISMGLISLPIMLRY
GYDRRVASGVIAASGTLAQIIPPSLVLIVMADQLNRSVGDMYEGAFVPGLLLASLYAVYI
FIISSIFPNAAPGLPLEAQTLRDPEQKTLPSRIMGAVAAAGFAFLIARGSLPGLTAGALP
GVANMAVWGIGSFVVLFFIMSGTAKLLTPSLFIALALSIAGAIELMEMSHVKFGADYVVL
TMSATVGIAFVVAVINRVFRLKLLSKLAEQVVFVMVPPLALIFLVLGTIFIGVATPTEGG
AMGSLGAVILAFARGRLKFDLLRQATYSTAKLSAFVLFILLGARVFSLTFYGVDGHKWVE
ELLVSLPGGQTGFLIAVNALVFVLAFFLDYFELAFIIIPLLGPAADKMGIDLIWFGVMLA
VNMQTSFMHPPFGFALFFLRSVAAKVPYVDRVTGKMMQPVTTGQIYWGAVPFVCIQLVMV
ALIILFPGMVTHYKSGGIQLDQQQIQQQFENLTPGLDATSPPPLDLGFGK