Protein Info for PS417_06815 in Pseudomonas simiae WCS417

Annotation: beta-lactamase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00144: Beta-lactamase" amino acids 52 to 334 (283 residues), 105.7 bits, see alignment E=1.4e-34

Best Hits

KEGG orthology group: None (inferred from 93% identity to pfs:PFLU1394)

Predicted SEED Role

"Beta-lactamase class C and other penicillin binding proteins" in subsystem Beta-lactamase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TVK7 at UniProt or InterPro

Protein Sequence (357 amino acids)

>PS417_06815 beta-lactamase (Pseudomonas simiae WCS417)
MVRGLLCVALLFVTVAAYAETWPDKEWAKGTPLSGPAVDALDAYAFPARDDATRQGIRTD
ALLVIRDGQVIYERYATPTTASTPHLTWSVSKSLMATVLGVAYGENRFKLTDPAARFYPP
MKQHPTVTMADLLHWASGLDWQEDYEYAPLKSSVVAMLYTRGRGDMADFAADTEAATAPG
QVFRYSSGDTNILSATLKGMLGHKAYMSSPWDALFKPLGIRNATWETDADETFVASSYAY
LTARDLARVGLLMARDGRWGEHQLLPKDWVAFNRQPFDKYKAGQDEAVPGGHWWLNQGAP
RPWPDAPADTFAALGHWGQALFVMPEEHLVIVRYGDDRDGSYRHNELLKRVLAAVQP