Protein Info for GFF1339 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 2 RSc1752

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 186 to 209 (24 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details amino acids 273 to 302 (30 residues), see Phobius details amino acids 309 to 336 (28 residues), see Phobius details amino acids 347 to 369 (23 residues), see Phobius details amino acids 375 to 391 (17 residues), see Phobius details amino acids 398 to 417 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 49 to 323 (275 residues), 89.2 bits, see alignment E=1.3e-29

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 78% identity to vap:Vapar_2928)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (442 amino acids)

>GFF1339 ABC transporter, permease protein 2 RSc1752 (Variovorax sp. SCN45)
MNTATTTASTSTPVRYYRFKPLNIGRILIWSFFALLLIVAPMIFTSSLALTMLSQIGYLI
IICLSYNILLGQGGMLSFGHAVYVGLGSFIAIHAMNFASAGKLPIPLVLIPLVGGLGGMF
FAMVFGYVSTKKSGTTFAMITLGLGELVAAMALMFPSFFGGEGGITTNRVYGASFFGINF
GPQNQVYYLIAVYCFICTGLMFAFTGTPLGRMLNAVRDNPERVEFIGYNTQRVRYFAFII
AGFFAGIGGGLAAINFEIVNAADSLNGLRSGSYLLFTFLGGATFFFGPIIGAALLVFALV
LLSELSKAWLLYVGLVFLLMVMFAPGGVASLIMMNVRVALFGKIKRFYLLYVGLFIGAGV
MLAGAAAIVEMIYHMQLNAALGPLVPFAGLQLDTSSATSWIVAVALLAVGLGIFEVFRRR
FAKAWGQAQEEIEAEIKRRETA