Protein Info for GFF1338 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 1 RSc1751

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 6 to 32 (27 residues), see Phobius details amino acids 35 to 84 (50 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details amino acids 222 to 259 (38 residues), see Phobius details amino acids 262 to 264 (3 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 10 to 259 (250 residues), 119.1 bits, see alignment E=9.7e-39

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 94% identity to vpe:Varpa_3190)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>GFF1338 ABC transporter, permease protein 1 RSc1751 (Variovorax sp. SCN45)
MNVEFFVISLLNGVSYGLLLFMLSSGLTLIFSMMGVLNFAHASFYMLGAYFAFTISGILG
FWPALVIAPLLVFALGAAFERYCLRRVHKFGHVPELLVTFGLSYLILEIVQLVWGRSTVP
YGLPTALQGPLFSLYGTQFPKSRSFIMLVAVLMLVSVWLLLTRTRIGLVIQAALKHPDMV
EALGHNVPRVFMLVFGGGAALAGLAGVVGGNTYVTEPAMAGSVGSIIFVVVVVGGMGSLA
GAFLASLIIGIVQTFAVAMDQSLATGLQALGVAVTDQTFGYELLKLTISQVAPILPYLFL
VLILIFRPKGLLGTRED