Protein Info for PS417_06800 in Pseudomonas simiae WCS417

Annotation: ACP phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 PF04336: ACP_PD" amino acids 1 to 182 (182 residues), 220.9 bits, see alignment E=7.3e-70

Best Hits

Swiss-Prot: 37% identical to ACPH_KLEP7: Acyl carrier protein phosphodiesterase (acpH) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 93% identity to pfs:PFLU1390)

MetaCyc: 37% identical to acyl carrier protein phosphodiesterase (Escherichia coli K-12 substr. MG1655)
[Acyl-carrier-protein] phosphodiesterase. [EC: 3.1.4.14]

Predicted SEED Role

"Acyl carrier protein phosphodiesterase (EC 3.1.4.14)" in subsystem Fatty Acid Biosynthesis FASII (EC 3.1.4.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TYZ4 at UniProt or InterPro

Protein Sequence (194 amino acids)

>PS417_06800 ACP phosphodiesterase (Pseudomonas simiae WCS417)
MNYLAHLHLGGQLPAQLLGSLYGDFVKGRLQGQFSPQIESAIQLHRSIDRFTDSHPLVGE
ALSRFSLTRRRYAGIVLDVFFDHCLARDWTLYADQPLEHFTSQVYRVLAAEPQLPGRLAQ
IAPYMAADDWLGSYREFAVMEQVLRGIARRLTQPEELGHAMQELRELYEPLSEDFRLFYP
ELQAFAHSRLTPSI