Protein Info for GFF1333 in Xanthobacter sp. DMC5

Annotation: Single-stranded-DNA-specific exonuclease RecJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 599 transmembrane" amino acids 209 to 231 (23 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details TIGR00644: single-stranded-DNA-specific exonuclease RecJ" amino acids 44 to 594 (551 residues), 525.6 bits, see alignment E=5.9e-162 PF01368: DHH" amino acids 98 to 231 (134 residues), 78.5 bits, see alignment E=8.5e-26 PF02272: DHHA1" amino acids 377 to 470 (94 residues), 55.3 bits, see alignment E=1.2e-18 PF17768: RecJ_OB" amino acids 485 to 594 (110 residues), 75.3 bits, see alignment E=5.8e-25

Best Hits

KEGG orthology group: K07462, single-stranded-DNA-specific exonuclease [EC: 3.1.-.-] (inferred from 89% identity to xau:Xaut_4751)

Predicted SEED Role

"Single-stranded-DNA-specific exonuclease RecJ (EC 3.1.-.-)" in subsystem DNA-replication or DNA Repair Base Excision or DNA repair, bacterial RecFOR pathway (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (599 amino acids)

>GFF1333 Single-stranded-DNA-specific exonuclease RecJ (Xanthobacter sp. DMC5)
VNIAVPNRLFLDVARSATGRTWRERLDVRGGQTALAMAQRFGISELLARVLAARNVGLDE
VERYLDPSIRTLLPDPDTLTDMPAAVARLARAVTTGEQVAVFGDYDVDGACSTALMVGVL
QAGGLDPFFHIPDRIFEGYGPNVPAIEQLAARGVTLLVTVDCGTTSLEPLAAAKRLGMDV
VVIDHHQAGETLPPATAIVNPNREDDLSGLGHVCAAGLAFVVAVGLVRALRQSGHFNAER
PAPDLLEALDIVALATVADVVPLIGLNRAFVAKGLIAMRRRTRIGLTALMDAARLDGPPR
PFHLGFLIGPRINAGGRIGEATLGARLLLTQDPAEARGIAAELDRLNAERQEVERAILAA
AEAEAHAALGISEEGAVVVVSGEGWHPGVVGLVAARLKERFQRPAFAIAFNGETGTGSGR
SIPGVDIGRAVRGAVESGLLVKGGGHAMAAGLTVERRQLGALRAELEQRLAPDVERARAE
GTLSIDGALTARGATLDLVETVSRAGPFGAGNPEPVFAFPGHRISYVESFGAGHVRARIS
SPDGTTLKATAFRCAEEPLGRALLAARGRNLHVAGCLDIDTWQGETRVALRIRDVAEAG