Protein Info for GFF1330 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Deoxyguanosinetriphosphate triphosphohydrolase (EC 3.1.5.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 TIGR01353: putative dGTPase" amino acids 27 to 383 (357 residues), 287.7 bits, see alignment E=1e-89 PF01966: HD" amino acids 65 to 210 (146 residues), 49.5 bits, see alignment E=5e-17 PF13286: HD_assoc" amino acids 297 to 381 (85 residues), 95.6 bits, see alignment E=2.1e-31

Best Hits

Swiss-Prot: 58% identical to DGTL1_BORBR: Deoxyguanosinetriphosphate triphosphohydrolase-like protein (BB0073) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: K01129, dGTPase [EC: 3.1.5.1] (inferred from 68% identity to pol:Bpro_0788)

Predicted SEED Role

"Deoxyguanosinetriphosphate triphosphohydrolase (EC 3.1.5.1)" in subsystem Purine conversions (EC 3.1.5.1)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (389 amino acids)

>GFF1330 Deoxyguanosinetriphosphate triphosphohydrolase (EC 3.1.5.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPAGLADCASSPAHSRGRRHPEPEAPTRTAFQRDRDRVIHSTAFRRLVYKTQVFLNHEGD
LFRTRLTHSLEVAQLGRSIARSLHLNEDLVEAIALAHDLGHTPFGHAGQDALNACLKAAS
AQAAPGDTDSWGFEHNLQSLRVVDELEERYPAFDGLNLCFETREGILKHCSKANALRLEQ
QEPGGVASRFLHGGSPSLEAQLCNLADEIAYNAHDIDDGVRSGLLTMDQMADVELFEHYR
RTALKAHPQLQGRRLLFESIRLMLSDQVYDVIDTTRARLSAAQVHSVEAVRARPPLVAFS
DGMRERSQVLKSFLFRNLYRHPQVMETTDRARRVVSDLFDRYMNAPGELPEAHGRKQHLA
RAVADYIAGMTDRFAIREHERLYGAVLFP