Protein Info for GFF1321 in Variovorax sp. SCN45

Annotation: Probable diguanylate cyclase YeaP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF13185: GAF_2" amino acids 16 to 151 (136 residues), 36.6 bits, see alignment E=7.3e-13 PF01590: GAF" amino acids 18 to 152 (135 residues), 38.1 bits, see alignment E=3.3e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 170 to 336 (167 residues), 139.6 bits, see alignment E=4.1e-45 PF00990: GGDEF" amino acids 173 to 334 (162 residues), 129.4 bits, see alignment E=1.7e-41

Best Hits

KEGG orthology group: K13069, diguanylate cyclase [EC: 2.7.7.65] (inferred from 66% identity to vpe:Varpa_3204)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>GFF1321 Probable diguanylate cyclase YeaP (Variovorax sp. SCN45)
MDSLIEQLSDSVASAKTLEDLARPMLEMLEVVTGLESTYLTTIDLEKGLQHILFARNVKE
MTIPEGISVPWSDTLCRRALEEGRTFTDDVADCWGDSDAARDLGIRTYVSTPVRTENGGL
FGTLCAASAVKLPLSPHAEPVLRLFAKLIAQQVERELLFIKLKRANAELAAYASTDTLTG
LPNRRTLIDALRRLLAQCEREGRSTLVGFIDMDGFKKINDTHGHDVGDEFLSAMAGRLSA
SLRASDVLARFGGDEFVVIGAGPTFDESPRTAARALADRLGESTIGDLRLTRGTTIEYGG
ASVGVVAIDPRTVSAEEALKLADTAMYNVKRERRATAIPREAQSD