Protein Info for GFF1317 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 signal peptide" amino acids 1 to 14 (14 residues), see Phobius details PF13420: Acetyltransf_4" amino acids 24 to 185 (162 residues), 46.6 bits, see alignment E=6e-16 PF13302: Acetyltransf_3" amino acids 30 to 166 (137 residues), 72 bits, see alignment E=1.3e-23 PF00583: Acetyltransf_1" amino acids 65 to 165 (101 residues), 45.7 bits, see alignment E=1.1e-15

Best Hits

KEGG orthology group: K03790, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 80% identity to xau:Xaut_3526)

Predicted SEED Role

"Ribosomal-protein-S5p-alanine acetyltransferase" in subsystem Ribosomal protein S5p acylation or Ribosome biogenesis bacterial

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.128

Use Curated BLAST to search for 2.3.1.128

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>GFF1317 hypothetical protein (Xanthobacter sp. DMC5)
MWLSALFPFPAEPLPAIEGKGVYLRVPQMKDFVAWRTLRDISRGFLTPWEPLWPSDDLTR
GAFRRRLRRYARDMVTDEAYPLFIFRRVDDELVGGLTLSNVRRGVCQAASLGYWMGAPYA
GQGYMRAAVTALLPVAHDVLHLRRVEAACMPNNQASIRLLESCGFTREGYSREYLCINGT
WEDHILFARLKSDPIARLMSREETLATRLSRVPPAAQ