Protein Info for GFF131 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Type IV pilin PilA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details PF07963: N_methyl" amino acids 3 to 25 (23 residues), 36.6 bits, see alignment 2.3e-13 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 4 to 27 (24 residues), 35.1 bits, see alignment 4e-13 PF00114: Pilin" amino acids 36 to 126 (91 residues), 23.4 bits, see alignment E=9.6e-09

Best Hits

Swiss-Prot: 90% identical to PPDD_ECOLI: Prepilin peptidase-dependent protein D (ppdD) from Escherichia coli (strain K12)

KEGG orthology group: K02682, prepilin peptidase dependent protein D (inferred from 97% identity to ses:SARI_02851)

Predicted SEED Role

"Type IV pilin PilA" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (145 amino acids)

>GFF131 Type IV pilin PilA (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MEKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQTFVPYRTAVELCALEH
GGTSTCDAGVNGIPSPVITRYVSGMSVEKGVITLTGQESLSGLSVIMTPAWDNANGITGW
TRNCNIQSDSALQQACEDVFRFDAN