Protein Info for GFF1309 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 TIGR00735: imidazoleglycerol phosphate synthase, cyclase subunit" amino acids 1 to 258 (258 residues), 369 bits, see alignment E=5.2e-115 PF00977: His_biosynth" amino acids 5 to 242 (238 residues), 285 bits, see alignment E=4.2e-89

Best Hits

Swiss-Prot: 90% identical to HIS6_POLSJ: Imidazole glycerol phosphate synthase subunit HisF (hisF) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K02500, cyclase [EC: 4.1.3.-] (inferred from 90% identity to lch:Lcho_1592)

MetaCyc: 49% identical to imidazole-glycerol-phosphate synthase cycloligase subunit (Thermotoga maritima)
GLUTAMIDOTRANS-RXN [EC: 4.3.2.10]

Predicted SEED Role

"Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-)" in subsystem Histidine Biosynthesis (EC 4.1.3.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.-

Use Curated BLAST to search for 4.1.3.- or 4.3.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>GFF1309 Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLAKRIIPCLDVTGGRVVKGVNFVELRDAGDPVEIAARYNEQGADELXFLDITATSDGRD
LILHIIEAVASEVFIPLTVGGGVRTVEDVRRLLNAGADKTSFNSAAIANPQVIRDASDKY
GAQCIVVAIDAKRRLGDDLAQRGEGWDVYSHGGRKNTGLDVVAWASQMADFGAGEILLTS
MDRDGTKSGFDLALTRAVADAVSVPVIASGGVGNLDHLADGVQQGGADAVLAASIFHYGE
FTVAQAKARMAERGIPVRR