Protein Info for GFF1308 in Xanthobacter sp. DMC5

Annotation: Caffeine dehydrogenase subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 13 to 66 (54 residues), 32 bits, E=9.9e-12
• PF01799: Fer2_2
  • amino acids 80 to 153 (74 residues), 103.2 bits, E=6.5e-34

Best Hits

Swiss-Prot: 50% identical to DCMS_OLICO: Carbon monoxide dehydrogenase small chain (coxS) from Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)

KEGG orthology group: None (inferred from 69% identity to bja:bll6238)

MetaCyc: 50% identical to carbon monoxide dehydrogenase small chain (Afipia carboxidovorans)
RXN-17357 [EC: 1.2.5.3]

Predicted SEED Role

"Carbon monoxide dehydrogenase small chain (EC 1.2.99.2)" in subsystem CO Dehydrogenase (EC 1.2.99.2)

MetaCyc Pathways

• carbon monoxide oxidation to CO₂ (1/1 steps found)

KEGG Metabolic Maps

• Methane metabolism
• Trinitrotoluene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.2.99.2

Use Curated BLAST to search for 1.2.5.3 or 1.2.99.2

Protein Sequence (165 amino acids)

>GFF1308 Caffeine dehydrogenase subunit gamma (Xanthobacter sp. DMC5)
MNMMAGAGPLSLTVNGEEVARMVAPRTTLADFLRTDLELTATHVGCEMGACGACLVLLDG
VPVHSCLVFAVQAQGQSVETVEGLVASGALAPLQQAFHERNALQCGFCTPGMLVNAHALI
ARGGVPDREEIRDAISGNYCRCTGYEAIVDAIEVAARKANGEGAE