Protein Info for GFF1305 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein (cluster 3, basic aa/glutamine/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details amino acids 321 to 341 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 142 to 238 (97 residues), 66.4 bits, see alignment E=1.4e-22 PF00528: BPD_transp_1" amino acids 160 to 348 (189 residues), 69.5 bits, see alignment E=1.6e-23

Best Hits

KEGG orthology group: K09971, general L-amino acid transport system permease protein (inferred from 96% identity to vap:Vapar_2944)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (351 amino acids)

>GFF1305 ABC transporter, permease protein (cluster 3, basic aa/glutamine/opines) (Variovorax sp. SCN45)
MRNVAQGPIAWRSELWGSPLRALATVLLLALLAWGGFHVVEWGVVHAVFRPDAEACRAVQ
HGACWGVVAEKWRPMLFGRFPYEEQWRPAVAVVVLSAVTVLSAWPRSWRWWLAPLWIVAL
LLFVLLMRGGVLGLSGVPTSRWGGLPLTIGLAVVGLALAFPLALLLALGRRSGWPVVRTL
SASYIELVRGVPLISVLFMASFLLPLLWPAGWQPDVLVRVLAGLTLFVAAYLAEIIRGGL
QAVPRGQTEVAMALGFGRWPVQRDIVLPQALRLVVPALTNSVVGTLKDTSLVTVVGLFEL
TGALGLALGGDPTWRPFYLEGYLFIAAVYWVLCFGLSRYSVWLEKRLSAAP