Protein Info for GFF1303 in Variovorax sp. SCN45

Annotation: Glutamate/aspartate ABC transporter, substrate-binding protein GltI (TC 3.A.1.3.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00497: SBP_bac_3" amino acids 41 to 246 (206 residues), 58.7 bits, see alignment E=2.6e-20

Best Hits

Swiss-Prot: 54% identical to AAPJ_RHIL3: General L-amino acid-binding periplasmic protein AapJ (aapJ) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K09969, general L-amino acid transport system substrate-binding protein (inferred from 96% identity to vpe:Varpa_3219)

Predicted SEED Role

"Glutamate Aspartate periplasmic binding protein precursor GltI (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>GFF1303 Glutamate/aspartate ABC transporter, substrate-binding protein GltI (TC 3.A.1.3.4) (Variovorax sp. SCN45)
MMNTRFRPALLAAASVIAFAAAAPAFAGKTLDAVKQRGTVKCGVTNGVAGFSAPDTQGNW
SGLDVDTCRAIAAAVLGDGKKVDFVPLNSQQRFSALQAGEIDILARNTTWTLTRDASLGF
NFTTITYYDGQGFLVPKKLKVTSAKQLKNATICTQSGTTNEKNVSDYFRAQGIPVKTVVF
ESFEASFKAFFSGRCQAFTTDASALAGLRNKEAPNPDDYVILPELISKEPLAPLVRRGDD
EWFAIAKWVPNALIEAEEAGVTQANADELKANSKDPAQQRLVGTGEDLGKLLGLDKEWSF
RAIKAVGNYGEMFERNVGPKSVLKLPRGSNNLWSKGGLIYAPPVR