Protein Info for GFF1301 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF10604: Polyketide_cyc2" amino acids 3 to 143 (141 residues), 31.8 bits, see alignment E=2.2e-11 PF06240: COXG" amino acids 5 to 144 (140 residues), 126 bits, see alignment E=1.5e-40 PF03364: Polyketide_cyc" amino acids 9 to 69 (61 residues), 30.1 bits, see alignment E=7.7e-11

Best Hits

KEGG orthology group: K09386, hypothetical protein (inferred from 64% identity to mch:Mchl_1445)

Predicted SEED Role

"carbon monoxide dehydrogenase G protein" in subsystem CO Dehydrogenase or Carbon monoxide dehydrogenase maturation factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (157 amino acids)

>GFF1301 hypothetical protein (Xanthobacter sp. DMC5)
VELTGEYRISAPRETVWKAILDPEMLKRCIPGCKELEQTGDNAYAAKVQVKVGPVSATFS
GSVELTDMEAPAGCRIVGQGNGGIAGFAKGEAKVSLAEDGADTILTYVADAQIGGKLASL
GGRLVQATAKKLSDQFFTSFAEALNAPAEVPPAAEAS