Protein Info for GFF1301 in Sphingobium sp. HT1-2

Annotation: Signal peptide peptidase SppA (protease 4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 627 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details TIGR00705: signal peptide peptidase SppA, 67K type" amino acids 19 to 543 (525 residues), 491.6 bits, see alignment E=3e-151 PF01343: Peptidase_S49" amino acids 127 to 280 (154 residues), 70.5 bits, see alignment E=8.3e-24 amino acids 377 to 528 (152 residues), 134.3 bits, see alignment E=1.9e-43

Best Hits

KEGG orthology group: K04773, protease IV [EC: 3.4.21.-] (inferred from 77% identity to sjp:SJA_C1-22970)

Predicted SEED Role

"Periplasmic serine protease"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (627 amino acids)

>GFF1301 Signal peptide peptidase SppA (protease 4) (Sphingobium sp. HT1-2)
LAFVKGAWRILVAIKDGLVLLFLLLFFGLLYAALSFSPKPAKPIGSGALLLDLDGSIVEQ
PAEVSATAILSGSGDQAKEYRLSDILTALDAARTDDKVKAVVLDLDDFTGGGQVAIARVG
KALDAVRAAKKLVFAFATLYSDDSYQLAAHASEAWVDPMGGVAIAGRGGSGLYYKGLIDK
LGVNTHVYRVGTYKSFVEPYIRADQSPAAKQANQELAGALWQNWQDDVTRARPKAKVAAY
AADPAAAASAAGGDMAKAALAAGLVDQLGDQDAFEERVAKVAGDPSDKDDTDYAAIDYAA
YVKARKPANDGQIGVLTVAGDIVDGEAGPGTAAGDTISDLLLKALDEKDLKALVVRVDSP
GGSVQASEKIRRAIMEAKSGGLPIVVSMGNVAASGGYWVSTPADIVFAEPDTITGSIGVF
GIIPSFEGTLAKMGITTDGVRTTPLSGQPDIAGGTTPQFDQIMQMGVEDIYRRFVGLVAQ
ARHKTPAQIDTIAQGRVWDGGTARQIGLIDRFGDLNDAIAEAARRAKIDPAKAKPYWIEK
QPDKFAEFIQSIADREKDDAGAPRDLIGREAKLQQRWALQAVADVRALVSGAGVRADCLE
CRGYGAPRPANQADARGWLALLKTAWH