Protein Info for PS417_06605 in Pseudomonas simiae WCS417

Annotation: leucine/isoleucine/valine transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 40 to 60 (21 residues), see Phobius details amino acids 91 to 107 (17 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 140 to 157 (18 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 194 to 210 (17 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 310 to 332 (23 residues), see Phobius details amino acids 348 to 375 (28 residues), see Phobius details amino acids 387 to 404 (18 residues), see Phobius details PF11862: DUF3382" amino acids 5 to 104 (100 residues), 62.3 bits, see alignment E=4.4e-21 PF02653: BPD_transp_2" amino acids 113 to 398 (286 residues), 199.8 bits, see alignment E=4.9e-63

Best Hits

Swiss-Prot: 80% identical to BRAE_PSEAE: High-affinity branched-chain amino acid transport system permease protein BraE (braE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to pfs:PFLU1344)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TVI7 at UniProt or InterPro

Protein Sequence (417 amino acids)

>PS417_06605 leucine/isoleucine/valine transporter permease subunit (Pseudomonas simiae WCS417)
MSRYLKSAFFSALLVWAVAFPVLGLKLSIVGINLEVHGTGPVTLTIIALCSVLMFLRVLF
TQQVGALFKSNRGPLVSPKVSQFLTLPRTQRYIIIALIIAALIWPFFGSRGAVDIATLIL
IYVLLGLGLNIVVGLAGLLDLGYVGFYAVGAYTYALLSHYLGWSFWICLPLAGMAAATFG
FLLGFPVLRLRGDYLAIVTLGFGEIIRLFLRNLTDITGGPNGISSIPKPTFFGLSFDRTA
AEGMQTFHEYFGIDYNPVSKVVFLYLVALLLALAALFVINRLLRMPIGRAWEALREDEIA
CRALGLNPTIIKLSAFTLGAAFAGFAGSFFAARQGLVTPESFTFIESAIILAIVVLGGMG
SQLGVILAAIVMILLPEMMREFSEYRMLMFGAMMVLMMIWRPQGLLPMQRPHMELRK