Protein Info for GFF1300 in Sphingobium sp. HT1-2

Annotation: Phosphoglycerate mutase (EC 5.4.2.11)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01258: phosphoglycerate mutase 1 family
  • amino acids 3 to 227 (225 residues), 352.6 bits, E=5.5e-110
• PF00300: His_Phos_1
  • amino acids 4 to 130 (127 residues), 101.9 bits, E=1.8e-33
  • amino acids 139 to 217 (79 residues), 27.5 bits, E=1.2e-10

Best Hits

Swiss-Prot: 88% identical to GPMA_SPHWW: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (gpmA) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 94% identity to sch:Sphch_1133)

MetaCyc: 62% identical to phosphoglycerate mutase 1 (Homo sapiens)
Bisphosphoglycerate mutase. [EC: 5.4.2.4]; RXN-15513 [EC: 5.4.2.4, 5.4.2.11]

Predicted SEED Role

"Phosphoglycerate mutase (EC 5.4.2.1)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.4.2.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• heterolactic fermentation (16/18 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• homolactic fermentation (11/12 steps found)
• Bifidobacterium shunt (13/15 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• gluconeogenesis I (11/13 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• Rubisco shunt (8/10 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• glycolysis IV (7/10 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• Rapoport-Luebering glycolytic shunt (1/3 steps found)
• glycolysis V (Pyrococcus) (6/10 steps found)
• formaldehyde assimilation I (serine pathway) (8/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• glycerol degradation to butanol (10/16 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
• photorespiration II (5/10 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (7/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (19/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.1

Use Curated BLAST to search for 5.4.2.1 or 5.4.2.11 or 5.4.2.4

Protein Sequence (228 amino acids)

>GFF1300 Phosphoglycerate mutase (EC 5.4.2.11) (Sphingobium sp. HT1-2)
MPTLVLIRHGQSTWNLENRFTGWWDVDVTEKGVEEARAAGRLLKEKGLDFDQCYTSVQSR
AIKTLNLVLEEMGRLWLPVEKDWRLNERHYGGLTGLNKAETAAKHGDDQVKIWRRSFDVP
PPVLEAGSEFDLSKDRRYDGIAIPSTESLKDTIARVLPYWESVIAPDLKAGKRVVISAHG
NSLRALVKHLSNIPDDEITELEIPTGQPIVYELADDLTATDRYYLSER