Protein Info for PS417_06575 in Pseudomonas simiae WCS417

Annotation: DoxX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 95 to 124 (30 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details PF07681: DoxX" amino acids 25 to 125 (101 residues), 54.7 bits, see alignment E=1.3e-18

Best Hits

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU1338)

Predicted SEED Role

"INTEGRAL MEMBRANE PROTEIN (Rhomboid family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U617 at UniProt or InterPro

Protein Sequence (161 amino acids)

>PS417_06575 DoxX (Pseudomonas simiae WCS417)
MNTRPSYLINRVIALFEQIPYSLIAFLARFSIAAVFWKSGQTKVEGFAIDLISGTFQLGE
PKLAASTLPLFRSEYHVPLLSPEVAAPMAAFAEHFFPVLILVGFATRFSALALIGMTLVI
QLFVYPDAYPTHGTWIALLLLLVAKGPGRLSIDHLIARRYA