Protein Info for GFF1292 in Variovorax sp. SCN45

Annotation: Macrolide-specific efflux protein MacA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 40 to 373 (334 residues), 186.1 bits, see alignment E=4e-59 PF25973: BSH_CzcB" amino acids 63 to 213 (151 residues), 32.3 bits, see alignment E=1.9e-11 PF25917: BSH_RND" amino acids 63 to 212 (150 residues), 64.5 bits, see alignment E=1.6e-21 PF25944: Beta-barrel_RND" amino acids 224 to 303 (80 residues), 61.8 bits, see alignment E=1.7e-20 PF25954: Beta-barrel_RND_2" amino acids 227 to 300 (74 residues), 26.2 bits, see alignment E=1.9e-09 PF25967: RND-MFP_C" amino acids 307 to 367 (61 residues), 44.3 bits, see alignment E=3.5e-15

Best Hits

Swiss-Prot: 45% identical to MACA_ECO57: Macrolide export protein MacA (macA) from Escherichia coli O157:H7

KEGG orthology group: K13888, macrolide-specific efflux protein MacA (inferred from 87% identity to vpe:Varpa_2700)

MetaCyc: 44% identical to ABC-type tripartite efflux pump membrane fusion protein (Escherichia coli K-12 substr. MG1655)
7.6.2.-; 7.6.2.-; 7.6.2.-

Predicted SEED Role

"Macrolide-specific efflux protein MacA" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>GFF1292 Macrolide-specific efflux protein MacA (Variovorax sp. SCN45)
MPNTQPRRSRKYFIGILVLVVLGLVAFVGLSPARKPEYLTASVQRTDLENAVLATGVLQA
LKQVEVGAQVSGQLKSLKVVLGQTVKKGDWLAEIDPVISQNTLAQEQAKLDNLQAQKLAK
EVRIRQAQLSWTRQQEMLAQDAAAKQDMESADAELRALRADGVSLDAQIRQQRLALASAQ
TNLSYTRIVAPIDGDVVSISTLEGQTVVASFQVPTLMKLADLSTMTVKAQVSEADVVRVK
AGQPVYFTILGDPDKRYYGTLRAVQPSPEKINNAVFFNALFDVPNPDRTLRVDMTAQVAI
MLGEAKQALVVPLTALGTRDKDGRQEVRVLKADQSVEKRMVRVGISNNFQAQVLEGLKEG
DKVITGDASALADRPDGGGPRGKAQ