Protein Info for GFF1290 in Variovorax sp. SCN45

Annotation: Sulfate and thiosulfate import ATP-binding protein CysA (EC 3.6.3.25)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 TIGR00968: sulfate ABC transporter, ATP-binding protein" amino acids 3 to 241 (239 residues), 411.4 bits, see alignment E=5.5e-128 PF00005: ABC_tran" amino acids 18 to 164 (147 residues), 137.1 bits, see alignment E=1.3e-43 PF17850: CysA_C_terminal" amino acids 241 to 283 (43 residues), 65.7 bits, see alignment 8.7e-22 PF12857: TOBE_3" amino acids 289 to 352 (64 residues), 54.1 bits, see alignment E=2.4e-18

Best Hits

Swiss-Prot: 74% identical to CYSA_BORBR: Sulfate/thiosulfate import ATP-binding protein CysA (cysA) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: K02045, sulfate transport system ATP-binding protein [EC: 3.6.3.25] (inferred from 97% identity to vpe:Varpa_2698)

Predicted SEED Role

"Sulfate and thiosulfate import ATP-binding protein CysA (EC 3.6.3.25)" in subsystem Cysteine Biosynthesis (EC 3.6.3.25)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.25

Use Curated BLAST to search for 3.6.3.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>GFF1290 Sulfate and thiosulfate import ATP-binding protein CysA (EC 3.6.3.25) (Variovorax sp. SCN45)
MSIEIRNISKQFGDFRALRDVNLDVESGELVALLGPSGCGKTTLLRIIAGLETADSGSIL
FSGEDTTDVHVRERQVGFVFQHYALFRHMTVFENVAFGLRVKPRKERPSDAQIKAKVTDL
LKLVQLDWLADRYPSQLSGGQRQRIALARALAVEPKVLLLDEPFGALDAKVRKELRRWLR
RLHDELHVTSIFVTHDQEEALEVADRVVVINKGQIEQVGSPQEVWDQPASPFVYGFLGDV
NLFHGRADNGAVQLDGMRLDSPEHSGARDAKARAYVRPHDIDVTRYVAGASGIVATLARA
IVVGPIARLELEPTESNPDNPGSGTIIEAQLPAQQFRDLGLKEGDTVVANPRKARVFVEE
DWVSP