Protein Info for GFF1285 in Sphingobium sp. HT1-2

Annotation: FIG00018398: hypothetical regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 36 to 53 (18 residues), see Phobius details amino acids 58 to 76 (19 residues), see Phobius details amino acids 82 to 106 (25 residues), see Phobius details PF04241: DUF423" amino acids 16 to 91 (76 residues), 57.2 bits, see alignment E=8.2e-20

Best Hits

Swiss-Prot: 32% identical to YWDK_BACSU: UPF0382 membrane protein YwdK (ywdK) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 80% identity to sch:Sphch_1121)

Predicted SEED Role

"hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (109 amino acids)

>GFF1285 FIG00018398: hypothetical regulator (Sphingobium sp. HT1-2)
MIAILAALSAALAIAAGAFGAHGAASPQAAEWLRTGGLYQLIHAVAVLTIMGITRGGALL
LLIGAAIFAVSLYAMALGCPRWLGAVTPIGGAMMIGGWLWAALAYWQRG