Protein Info for GFF1283 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FIG002842: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF07072: ZapD" amino acids 16 to 226 (211 residues), 266.9 bits, see alignment E=6.8e-84

Best Hits

Swiss-Prot: 52% identical to ZAPD_RALPJ: Cell division protein ZapD (zapD) from Ralstonia pickettii (strain 12J)

KEGG orthology group: None (inferred from 70% identity to pol:Bpro_0845)

Predicted SEED Role

"FIG002842: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>GFF1283 FIG002842: hypothetical protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
VILYDYPFNERIRTYLRLEQLFRRMVELVPRSHPLDHHYAIQTIFEIMDVAARADMKSDV
LKDLDRHKQHLIGFRGNPMIAEQALEEVIEKLENCFTQLSEMTGKTGQALTENDWLMSIR
SRIGIPGGTCEFDLPAYYHWQHRNAEDRRADLHRWSVPLAPLAESIVQLLKMLRESGSAQ
KVVAPGGQFQLTLPQGRSFQLLRLRIDPSTGLIPEISGNRLMLSVRLMRHGEDDRLHPAQ
EDAAFELTLCA